DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CG14780

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:271 Identity:94/271 - (34%)
Similarity:136/271 - (50%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRL----ETYMLLHICGGSIYAPRVVIT 68
            ||||.....:..:..|   .|:.|..|...:..:.||:||    ..:...|||||::.|||.|:|
  Fly    16 FLLACAAADLQENQQS---RIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLT 77

  Fly    69 AAHCI------KGRYASYIRIVAGQNSIADLEEQ-GVKVSKLIPHA---GYNKKTYVNDIGLIIT 123
            ||||:      :.|.||...:|.|  ::...|.: |..||::...|   .::..:..:|:|::..
  Fly    78 AAHCLYNNQRKRFRRASEFVVVLG--TLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFL 140

  Fly   124 REPLEYS------ALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCG 182
            |..|..|      ..|.||.:|.:..|.|....|:|||:  .:..:|..:|....:..|...||.
  Fly   141 RTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGR--TEQSSLSNILLTANVSTIRHQTCR 203

  Fly   183 AQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNS 247
            ..|.:   .:...|:|||.|:||.|:|.|||||||..:|.||||||||.||...|.||||..|..
  Fly   204 MIYRS---GLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEY 265

  Fly   248 HIDWIEEQAEA 258
            :..|||.::.|
  Fly   266 YRQWIEGRSGA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 85/244 (35%)
Tryp_SPc 28..255 CDD:238113 88/246 (36%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 85/244 (35%)
Tryp_SPc 33..271 CDD:238113 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.