DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss30

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:262 Identity:89/262 - (33%)
Similarity:127/262 - (48%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCI-KGRYASYIRIVAGQNSIA 91
            ||||..|....:|:|||:.:....  ||||||:.....|:|||||. :....|:..:..|     
Mouse    74 IVGGQDALEGQWPWQVSLWITEDG--HICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVG----- 131

  Fly    92 DLEEQGVKVSKLIPHAG-------YNKKTYV------NDIGLIITREPLEYSALVQPIAVALEAP 143
                 |:.:|.|.||:.       :...||:      .||.|:....||..|........|.:.|
Mouse   132 -----GLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFTPVCLPAAQTP 191

  Fly   144 -PSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDE------MLCAGY 201
             ..|....|:|||...|.|.|  ::|:.:.:.:::...|...|.|:..:::.|      ||||||
Mouse   192 LTPGTVCWVTGWGATQERDMA--SVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGY 254

  Fly   202 LEGGKDTCNGDSGGPLAV----DGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWI-----EEQAE 257
            :||.||:|.|||||||..    ....||:.|||:||.|...|||||.|.:::|||     |..::
Mouse   255 VEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILAENHSD 319

  Fly   258 AY 259
            ||
Mouse   320 AY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/248 (34%)
Tryp_SPc 28..255 CDD:238113 87/256 (34%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 86/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.