DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Elane

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:253 Identity:67/253 - (26%)
Similarity:115/253 - (45%) Gaps:31/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIK 74
            ||::.:.:|....::::.||||..|....:|:.||::....   |.||.::.|...|::||||:.
  Rat    15 LASMLLALLLVCPALASEIVGGRPAQPHAWPFMVSLQRRGG---HFCGATLIARNFVMSAAHCVN 76

  Fly    75 GRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIA 137
            ||....:::|.|.:.:...|  .|...|.::..: |::....:|||.:|    .|..||.:....
  Rat    77 GRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFEN-GFDPSRLLNDIVII----QLNGSATINANV 136

  Fly   138 VALEAPPSG------AQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEM 196
            ...|.|..|      ...|..||| |...:..||::|:.:.:.:: .:.|..:.          .
  Rat   137 QVAELPAQGQGVGNRTPCVAMGWG-RLGTNRPLPSVLQELNVTVV-TNLCRRRV----------N 189

  Fly   197 LCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSW--GVGCGREGFPGVYTSVNSHIDWI 252
            :|..........|.|||||||..:.::.|:.|:  | |||...:|..:..|....|||
  Rat   190 VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRG-GCGSGFYPDAFAPVAEFADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 62/234 (26%)
Tryp_SPc 28..255 CDD:238113 64/235 (27%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 62/234 (26%)
Tryp_SPc 33..249 CDD:238113 64/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.