DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Klk9

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:264 Identity:85/264 - (32%)
Similarity:128/264 - (48%) Gaps:20/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVI 67
            ::|||.|:.   ..:|.......|..||..:......|:|..:   .|:...:||.::...:.::
  Rat     1 MKLGLTLVL---FSLLAGHCGADTRAVGARECQRNSQPWQAGL---FYLTRQLCGATLINDQWLL 59

  Fly    68 TAAHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVN----DIGLIITREP 126
            |||||.|    .|:.:..|::.:...|  |:.:.|:...||.|:|.....|    ||.||.....
  Rat    60 TAAHCRK----PYLWVRLGEHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRK 120

  Fly   127 LEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYT 191
            :..|..|||:.::...|..|.|.::||||..:......|..|:...:.|::...|...|   ...
  Rat   121 VRLSPAVQPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLCRWAY---PGH 182

  Fly   192 VTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWG-VGCGREGFPGVYTSVNSHIDWIEEQ 255
            ::::|||||..|||:.:|.|||||||...|.|.|:||.| ..|.|...|.|||||..::||||..
  Rat   183 ISEKMLCAGLWEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYLDWIENT 247

  Fly   256 AEAY 259
            .|.|
  Rat   248 VEKY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 74/231 (32%)
Tryp_SPc 28..255 CDD:238113 77/233 (33%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.