DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Klk10

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:224 Identity:57/224 - (25%)
Similarity:102/224 - (45%) Gaps:21/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSIADLE-EQGVKVSKL 103
            |:|||:   .:.|...|.|.:.....|:|||||.:.:   .:|...|.:.:...: ||....:..
  Rat    59 PWQVSL---FHNLQFQCAGVLVDQNWVLTAAHCWRNK---PLRARVGDDHLLLFQSEQLRSTNSP 117

  Fly   104 IPHAGYNK--------KTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAED 160
            :.|..|..        ::..:|:.::....|:..::.|.|:.:..:......:..|||||..|..
  Rat   118 VFHPKYQPCSGPVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANR 182

  Fly   161 DEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVG 225
            .......|....:.::.:..|...|   ...:|:.|:||| ::..:|:|..||||||..|..|.|
  Rat   183 RVKYNRSLSCSRVTLLSQKQCETFY---PGVITNNMICAG-MDRDQDSCQSDSGGPLVCDNTLHG 243

  Fly   226 VVSWGV-GCG-REGFPGVYTSVNSHIDWI 252
            ::||.: .|| ...:|.||..:.::.:||
  Rat   244 ILSWSIYPCGAATQYPAVYAKICNYTNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 55/222 (25%)
Tryp_SPc 28..255 CDD:238113 57/224 (25%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 55/222 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.