DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Klk11

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:260 Identity:85/260 - (32%)
Similarity:132/260 - (50%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVV 66
            :|...:.:|..:.:.::|......|.|:.|.:......|:||::..:|.:|   ||.::.||:.:
  Rat    25 ALLQAMMILRFIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLL---CGATLIAPKWL 86

  Fly    67 ITAAHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYN----KKTYVNDIGLIITRE 125
            :|||||.|..|.    |:.|::::...:  ||....::..||.|:|    .|.:.|||.|:....
  Rat    87 LTAAHCRKPHYV----ILLGEHNLEKTDGCEQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMSS 147

  Fly   126 PLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDY 190
            |...:..|:|:.::.....:|...::||||..:.....||..||...:.||....|...|   ..
  Rat   148 PAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIGHKECERAY---PG 209

  Fly   191 TVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVG-CGREGFPGVYTSVNSHIDWIEE 254
            .:||.||||...:.|||:|.|||||||..:|.|.|::|||.. |.....|||||.|..:.|||.|
  Rat   210 NITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFDWIHE 274

  Fly   255  254
              Rat   275  274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 78/231 (34%)
Tryp_SPc 28..255 CDD:238113 81/234 (35%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 78/231 (34%)
Tryp_SPc 51..275 CDD:238113 81/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.