DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss34

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:276 Identity:107/276 - (38%)
Similarity:146/276 - (52%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFL-LAALG--VVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLL---HICGGSIYAPRV 65
            ||| |..||  :.:..||......||||.....:.||:|||:|.....|.   ||||||:..|:.
  Rat     9 LFLTLPCLGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQW 73

  Fly    66 VITAAHCI--KGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYV---NDIGLIITRE 125
            |:|||||:  |...||..|:..||..:.: .:|.:||:|:|.|..:::|...   .||.|:....
  Rat    74 VLTAAHCVELKEMEASCFRVQVGQLRLYE-NDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDS 137

  Fly   126 PLEYSALVQPIAVALEAPPSGAQAV-------VSGWGKRAEDDEAL--PAMLRAVELQIIEKSTC 181
            .:..|..|.|:::     |:.:|.:       |:|||. .|....|  |..||.|.:.|:..|.|
  Rat   138 TVVLSERVHPVSL-----PAASQRISSKKTWWVAGWGV-IEGHRPLPPPCHLREVAVPIVGNSDC 196

  Fly   182 GAQYLT---KDYT---VTDEMLCAGYLEGGKDTCNGDSGGPLA----VDGVLVGVVSWGVGCGRE 236
            ..:|.|   .|.|   :.|:||||| :| |:|:|..||||||.    ...|.|||||||:|||..
  Rat   197 EQKYRTYSSLDRTTKIIKDDMLCAG-ME-GRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCGLP 259

  Fly   237 GFPGVYTSVNSHIDWI 252
            .||||||.|.|::.||
  Rat   260 DFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 97/251 (39%)
Tryp_SPc 28..255 CDD:238113 99/252 (39%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 99/252 (39%)
Tryp_SPc 33..275 CDD:214473 97/250 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.