DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss29

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:288 Identity:96/288 - (33%)
Similarity:149/288 - (51%) Gaps:47/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAALGVVILTDSASIS-----------THIVGGDQADIADFPYQVSVRLETY---MLLHICGGS 59
            :|:.||:.::...:||:           ..||||:.|....:|:|||:|:..|   ..:||||||
  Rat     1 MLSQLGLTLIFLGSSIAGIPASVPEDVLVGIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGS 65

  Fly    60 IYAPRVVITAAHCIKGRYA--SYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLII 122
            |..|:.|:||||||....|  |..||..||..:.. .|:.:|||::|.|..:.:....:|:.|:.
  Rat    66 IIHPQWVLTAAHCIHESDADPSAFRIYLGQVYLYG-GEKLLKVSRVIIHPDFVRSGLGSDVALLQ 129

  Fly   123 TREPLEYSALVQPIAVALEAPPSGAQAV------VSGWGKRAEDDEALPA--MLRAVELQIIEKS 179
            ..:.:.....|:|:.::    |:..:..      |:|||. ....|:||.  .|:.|:::|::.:
  Rat   130 LAQSVRSFPNVKPVKLS----PASLEVTKKDVCWVTGWGS-VSMHESLPPPYRLQQVQVKIVDNT 189

  Fly   180 TCGAQYLTKDYT---------VTDEMLCAGYLEGGKDTCNGDSGGPLA--VDG--VLVGVVSWGV 231
            .|  :.|.::.|         :..:|||||  ..|:|:|.|||||||.  |.|  .||||||||.
  Rat   190 LC--EKLYRNATRLSNHGQRLILQDMLCAG--SHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGY 250

  Fly   232 GCGREGFPGVYTSVNSHIDWIEEQAEAY 259
            ||..:..||||..|...:.||..|.:.:
  Rat   251 GCALKDIPGVYARVQFFLPWITGQMQKF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 88/250 (35%)
Tryp_SPc 28..255 CDD:238113 90/252 (36%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.