DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Prss30

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:290 Identity:97/290 - (33%)
Similarity:142/290 - (48%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILTDSASISTH-----IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVV 66
            :|||.   :.|||.......|     ||||..|....:|:|||:|.|...  ||||||:.....|
  Rat     8 IFLLL---LQILTGGRGDILHSGAGKIVGGQDAPEGRWPWQVSLRTEKEG--HICGGSLIHEVWV 67

  Fly    67 ITAAHCI-KGRYASYIRIVAGQNSIADLEEQGVKVSKLIPHAG-------YNKKTYV------ND 117
            :|||||. :...:|:..:..|          |:.:|...||:.       :...||:      .|
  Rat    68 LTAAHCFCRPLNSSFYHVKVG----------GLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSGD 122

  Fly   118 IGLIITREPL---EYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKS 179
            |.|:....||   ::|.:..|.|.|...|  |....|:|||  |..:..|.::|:.:.:.:::..
  Rat   123 IALLRLDTPLQPSQFSPVCLPQAQAPLTP--GTVCWVTGWG--ATHERELASVLQELAVPLLDSE 183

  Fly   180 TCGAQY------LTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPL--AVDG--VLVGVVSWGVGCG 234
            .|...|      |:....:..:|||||::||.||:|.|||||||  |::.  :.||:.|||:||.
  Rat   184 DCERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWGIGCA 248

  Fly   235 REGFPGVYTSVNSHIDWI-----EEQAEAY 259
            |...|||||.|..::|||     |..::||
  Rat   249 RPNKPGVYTRVPDYVDWIQRTLAENHSDAY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 86/256 (34%)
Tryp_SPc 28..255 CDD:238113 88/258 (34%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.