DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and KLK9

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:266 Identity:91/266 - (34%)
Similarity:130/266 - (48%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHI----CGGSIYAP 63
            ::||  ||.|| :.:|.......|..:|.::......|:|..       |.|:    ||.::.:.
Human     1 MKLG--LLCAL-LSLLAGHGWADTRAIGAEECRPNSQPWQAG-------LFHLTRLFCGATLISD 55

  Fly    64 RVVITAAHCIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVN----DIGLII 122
            |.::|||||.|    .|:.:..|::.:...|  ||..:|:...||.|:||....|    ||.||.
Human    56 RWLLTAAHCRK----PYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIR 116

  Fly   123 TREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLT 187
            .......|..|||:.::......|.|.::||||..:......|..|:...:.|:|...|...|  
Human   117 LPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAY-- 179

  Fly   188 KDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGV-GCGREGFPGVYTSVNSHIDW 251
             ...::|.|||||..|||:.:|.|||||||..:|.|.||||.|. .|.|...|.|||||..::||
Human   180 -PGHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDW 243

  Fly   252 IEEQAE 257
            |:|..|
Human   244 IQEIME 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 79/235 (34%)
Tryp_SPc 28..255 CDD:238113 81/237 (34%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.