DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Tpsg1

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:248 Identity:83/248 - (33%)
Similarity:122/248 - (49%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 THIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRY-ASYIRIVAGQNS 89
            :.||||..|....:|:|.|:||..   :|:||||:.:|..|:|||||..|.. :|..::..|:.:
Mouse    85 SRIVGGHAAPAGTWPWQASLRLHK---VHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELT 146

  Fly    90 IADLEEQGVKVSKLIPHAGYNKKTYV-----------NDIGLIITREPLEYSALVQPIAVALEAP 143
            :.           |.||....|:..:           .||.|:....|:..|:.|||:.:. ||.
Mouse   147 VT-----------LSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLP-EAS 199

  Fly   144 PS---GAQAVVSGWGKRAEDDEALPAM-LRAVELQIIEKSTCGAQYLTKDYT-VTDEMLCAGYLE 203
            ..   |.|..|:|||...|.:...|.. |:..::.:::..||...|.:.:.: :..:||||   .
Mouse   200 ADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCA---R 261

  Fly   204 GGKDTCNGDSGGPLA--VDGV--LVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252
            |..|.|..||||||.  |.|.  ..||||||.||||...||||..|.::::||
Mouse   262 GPGDACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 81/245 (33%)
Tryp_SPc 28..255 CDD:238113 83/246 (34%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 83/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.