DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and Klk8

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001311327.1 Gene:Klk8 / 259277 MGIID:1343327 Length:260 Species:Mus musculus


Alignment Length:225 Identity:81/225 - (36%)
Similarity:120/225 - (53%) Gaps:25/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PYQVSV----RLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSI--ADLEEQGV 98
            |:|.::    ||       ||||.:...|.|:|||||.|.:|:  :|:  |.:|:  .|..||.:
Mouse    45 PWQAALFQGERL-------ICGGVLVGDRWVLTAAHCKKQKYS--VRL--GDHSLQSRDQPEQEI 98

  Fly    99 KVSKLIPHAGYNK---KTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAED 160
            :|::.|.|..||.   :.:.:||.||..:........|:|:.:|...|..|.:.::||||.....
Mouse    99 QVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSP 163

  Fly   161 DEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVG 225
            .|..|..|...|::|..::.|...|..|   :|:.|:||| ...|.|||.|||||||..||:|.|
Mouse   164 QENFPNTLNCAEVKIYSQNKCERAYPGK---ITEGMVCAG-SSNGADTCQGDSGGPLVCDGMLQG 224

  Fly   226 VVSWGVG-CGREGFPGVYTSVNSHIDWIEE 254
            :.|||.. ||:...|||||.:..:..||::
Mouse   225 ITSWGSDPCGKPEKPGVYTKICRYTTWIKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 79/221 (36%)
Tryp_SPc 28..255 CDD:238113 81/225 (36%)
Klk8NP_001311327.1 Tryp_SPc 32..252 CDD:214473 79/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.