DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and KLK5

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:238 Identity:79/238 - (33%)
Similarity:124/238 - (52%) Gaps:14/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNS 89
            |:.|:.|...|:...|:|.::.|....|  .||..:..|:.::|||||.|    ...|:..|..|
Human    64 SSRIINGSDCDMHTQPWQAALLLRPNQL--YCGAVLVHPQWLLTAAHCRK----KVFRVRLGHYS 122

  Fly    90 IADLEEQGVKV---SKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVV 151
            ::.:.|.|.::   .|.|||.||:...:.||:.||.....:..:..|:||.|:...|.:|.:.:|
Human   123 LSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLV 187

  Fly   152 SGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGP 216
            ||||.........|.:|:.:.:.::.:..|...|..:   :.|.|.|||. :.|:|:|.||||||
Human   188 SGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQ---IDDTMFCAGD-KAGRDSCQGDSGGP 248

  Fly   217 LAVDGVLVGVVSWG-VGCGREGFPGVYTSVNSHIDWIEEQAEA 258
            :..:|.|.|:|||| ..|.|...|||||::.....||:|..:|
Human   249 VVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 74/228 (32%)
Tryp_SPc 28..255 CDD:238113 76/230 (33%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 1/3 (33%)
Tryp_SPc 66..285 CDD:214473 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41500
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.