DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and CELA3B

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_031378.1 Gene:CELA3B / 23436 HGNCID:15945 Length:270 Species:Homo sapiens


Alignment Length:276 Identity:89/276 - (32%)
Similarity:133/276 - (48%) Gaps:33/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLR-LGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLE-TYMLLHICGGSIYAP 63
            |.|| |...||.|:.......|:..|:.:|.|:.|....:|:|||::.| :....|.||||:.||
Human     1 MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAP 65

  Fly    64 RVVITAAHCIKGRYASYIRIVAGQ--NSIADLEEQGVKVSK--LIPHAGYNKKTYV--NDIGLII 122
            ..|:||.|||..  :...::|.|:  .::.:..||.:.::.  |..|..:|:....  |||.|| 
Human    66 DWVVTAGHCISS--SRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALI- 127

  Fly   123 TREPLEYSALVQPIAVALEAPPSG------AQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTC 181
               .|..||.:.........||:|      ....::||| |...:..||..|:...|.:::...|
Human   128 ---KLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWG-RLYTNGPLPDKLQEALLPVVDYEHC 188

  Fly   182 GAQYLTKDYTVTDEMLCAGYLEGG-KDTCNGDSGGPL---AVDG--VLVGVVSW--GVGCGREGF 238
             :::.....:|...|:|||   |. :..|||||||||   ..||  .:.||.|:  ..||.....
Human   189 -SRWNWWGSSVKKTMVCAG---GDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRK 249

  Fly   239 PGVYTSVNSHIDWIEE 254
            |.|:|.|::.||||||
Human   250 PTVFTRVSAFIDWIEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 76/245 (31%)
Tryp_SPc 28..255 CDD:238113 80/248 (32%)
CELA3BNP_031378.1 Tryp_SPc 28..263 CDD:214473 76/245 (31%)
Tryp_SPc 29..266 CDD:238113 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.