DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and TPSD1

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:244 Identity:80/244 - (32%)
Similarity:128/244 - (52%) Gaps:38/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFLLAALGVVILTDSASIS---------THIVGGDQADIADFPYQVSVRLETYMLLHICGGSI 60
            |.|.|||   :.:|...|.::         |.||||.:|..:.:|:|||:|:.....:|.||||:
Human     9 LSLLLLA---LPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSL 70

  Fly    61 YAPRVVITAAHCIKG--RYASYIRIVAGQNSIADLEEQGVKVSKLIPHAGYNKKTYV----NDIG 119
            ..|:.|:|||||::.  :..:.:|:...:..:. .::|.:.||::|.|..:    |:    .||.
Human    71 IHPQWVLTAAHCVEPDIKDLAALRVQLREQHLY-YQDQLLPVSRIIVHPQF----YIIQTGADIA 130

  Fly   120 LIITREPLEYSALVQPIAV--ALEAPPSGAQAVVSGWGKRAEDDEALPA--MLRAVELQIIEKST 180
            |:...||:..|:.:..:.:  |.|..|.|....|:|||. .:::..||.  .|:.||:.::|...
Human   131 LLELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGD-VDNNVHLPPPYPLKEVEVPVVENHL 194

  Fly   181 CGAQYLTKDYT------VTDEMLCAGYLEGGKDTCNGDSGGPLA--VDG 221
            |.|:|.|..:|      |.|:|||||  ....|:|.|||||||.  |:|
Human   195 CNAEYHTGLHTGHSFQIVRDDMLCAG--SENHDSCQGDSGGPLVCKVNG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 72/213 (34%)
Tryp_SPc 28..255 CDD:238113 72/212 (34%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 72/212 (34%)
Tryp_SPc 38..240 CDD:214473 70/209 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.