DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and try-10

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:256 Identity:62/256 - (24%)
Similarity:102/256 - (39%) Gaps:70/256 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VILTDSASISTHIVGGDQAD----------IADFPYQVSVRLETYMLLHICGGSIYAPRVVITAA 70
            ::|....|.||.|:.|..|:          |..||...:         ::|||.:.||.:|||:|
 Worm    63 ILLLSFISYSTSIINGFSANSFDTLSLASVITRFPDGTT---------NVCGGVLIAPSIVITSA 118

  Fly    71 HCI--KGRYASYIRIVAGQ---NSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLII---TREPL 127
            ||:  ...:|...::..|.   |...|.|::....:..|....:|..:..||...:|   .|..:
 Worm   119 HCVFSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSHAMAISKKFFNDASEANDDVAVIFLPQRADV 183

  Fly   128 EYSALVQPIAVALEAPPSG-----------------AQAVVSGWG----KRAEDDEALPAMLRAV 171
            .:|.|...||   :.|.:|                 :...|:|||    |.|:..:::..|:..:
 Worm   184 CHSPLSLQIA---KLPSTGSVNFKETAPLTQLQLETSVCYVAGWGKTENKTAKYSDSVRQMMVNL 245

  Fly   172 ELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPL--AVDG--VLVGVVS 228
            .::.|.|.               :.|.|..:.|....|.||||.|:  .|:|  :|||.|:
 Worm   246 SVRRIGKR---------------KYLIAKAVTGSSRACMGDSGSPVYCFVNGKRILVGTVA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 58/245 (24%)
Tryp_SPc 28..255 CDD:238113 58/244 (24%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 57/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.