DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and KLK8

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:233 Identity:84/233 - (36%)
Similarity:125/233 - (53%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQNSI-- 90
            ::||.:......|:|.:: .:...||  |||.:.....|:|||||.|.:|.  :|:  |.:|:  
Human    78 VLGGHECQPHSQPWQAAL-FQGQQLL--CGGVLVGGNWVLTAAHCKKPKYT--VRL--GDHSLQN 135

  Fly    91 ADLEEQGVKVSKLIPHAGYNK---KTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVS 152
            .|..||.:.|.:.|||..||.   :.:.:|:.|:..|:.....:.|:||::|......|.:..||
Human   136 KDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVS 200

  Fly   153 GWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPL 217
            |||......|..|..|...|::|..:..|...|..:   :||.|:|||..:|. |||.|||||||
Human   201 GWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQ---ITDGMVCAGSSKGA-DTCQGDSGGPL 261

  Fly   218 AVDGVLVGVVSWGVG-CGREGFPGVYTSVNSHIDWIEE 254
            ..||.|.|:.|||.. |||...|||||::..::|||::
Human   262 VCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 82/229 (36%)
Tryp_SPc 28..255 CDD:238113 84/233 (36%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 82/229 (36%)
Tryp_SPc 78..300 CDD:238113 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41500
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.