DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and KLK11

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:289 Identity:93/289 - (32%)
Similarity:137/289 - (47%) Gaps:61/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFLLAALGVVILTDSASISTHIVGGDQADIADF-------PYQVSVRLETYMLLHICGGSIYA 62
            |.|.|||            ::|.:|||:...|..|       |:|.::..:|.:|   ||.::.|
Human    36 LQLILLA------------LATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLL---CGATLIA 85

  Fly    63 PRVVITAAHCIK-------------------------GRYASYIRIVAGQNSIADLE--EQGVKV 100
            ||.::|||||:|                         .||..::    ||:::...|  ||....
Human    86 PRWLLTAAHCLKPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHL----GQHNLQKEEGCEQTRTA 146

  Fly   101 SKLIPHAGYN----KKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDD 161
            ::..||.|:|    .|.:.|||.|:....|:..:..|:|:.::.....:|...::||||..:...
Human   147 TESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQ 211

  Fly   162 EALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGV 226
            ..||..||...:.|||...|...|   ...:||.|:||...|||||:|.|||||||..:..|.|:
Human   212 LRLPHTLRCANITIIEHQKCENAY---PGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGI 273

  Fly   227 VSWGVG-CGREGFPGVYTSVNSHIDWIEE 254
            :|||.. |.....|||||.|..::|||:|
Human   274 ISWGQDPCAITRKPGVYTKVCKYVDWIQE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/263 (32%)
Tryp_SPc 28..255 CDD:238113 87/266 (33%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 81/256 (32%)
Tryp_SPc 54..303 CDD:238113 84/259 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41500
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.