DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and PRSS21

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:263 Identity:91/263 - (34%)
Similarity:142/263 - (53%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVAGQN 88
            |::.||||:.|::..:|:|.|:||..   .|:||.|:.:.|..:|||||    :.:|       :
Human    38 ITSRIVGGEDAELGRWPWQGSLRLWD---SHVCGVSLLSHRWALTAAHC----FETY-------S 88

  Fly    89 SIADLEEQGVKVSKL--IPH----AGYNKKTYVN--------------DIGLIITREPLEYSALV 133
            .::|.....|:..:|  :|.    ..|..:.:|:              ||.|:....|:.|:..:
Human    89 DLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHI 153

  Fly   134 QPIAVALEAP----PSGAQAVVSGWGKRAEDDEALPA--MLRAVELQIIEKSTCGAQYLTKDY-- 190
            |||  .|:|.    .:.....|:||| ..::|||||:  .|:.|::.||..|.|...:|...:  
Human   154 QPI--CLQASTFEFENRTDCWVTGWG-YIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRK 215

  Fly   191 TVTDEMLCAGYLEGGKDTCNGDSGGPLAV--DGV--LVGVVSWGVGCGREGFPGVYTSVNSHIDW 251
            .:..:|:|||..:||||.|.||||||||.  :|:  .:|||||||||||...|||||:::.|.:|
Human   216 DIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEW 280

  Fly   252 IEE 254
            |::
Human   281 IQK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 88/256 (34%)
Tryp_SPc 28..255 CDD:238113 90/259 (35%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 90/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.