DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and LOC105945797

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_031761518.1 Gene:LOC105945797 / 105945797 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:259 Identity:91/259 - (35%)
Similarity:129/259 - (49%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAH 71
            |.|...||.....|    ...||||........||.||:...    .|.||||:.:.:.|::|||
 Frog     4 LLLCVLLGAAAAFD----DDKIVGGYTCAPNSVPYIVSLNAG----YHFCGGSLISSQWVVSAAH 60

  Fly    72 CIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQ 134
            |    :.:.|.:..|::.|...|  ||.:..:|:|.:.||:.:|..|||.||....|...:..|.
 Frog    61 C----FMNKIEVRLGEHDIKATEGTEQFINSAKVIKNKGYSPRTLDNDIMLIKLATPAILNQYVS 121

  Fly   135 PIAVALEAPPSG-----AQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTD 194
            |:.:     |||     |..::||||.........|.:|:.|...::....|...|..:   :|.
 Frog   122 PVPL-----PSGCIEPRANCLISGWGNTLSSGSNYPNLLQCVSAPVLTADECNKAYPGE---ITQ 178

  Fly   195 EMLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQAEA 258
            .|:|.|:||||||:|.||||||:..:|.|.|:||||.||..:.:|||||.|.::..|||....|
 Frog   179 NMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAEKNYPGVYTKVCNYNAWIESTVAA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 82/231 (35%)
Tryp_SPc 28..255 CDD:238113 85/233 (36%)
LOC105945797XP_031761518.1 Tryp_SPc 21..239 CDD:238113 85/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.