DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and prss59.2

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:254 Identity:91/254 - (35%)
Similarity:127/254 - (50%) Gaps:26/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAH 71
            |..|..||.....|    ...||||.:......|:|.|:. ..|   |.||||:.:...|::|||
Zfish     4 LVFLVLLGAAFALD----DDKIVGGYECQPNSQPWQASLN-SGY---HFCGGSLVSEYWVVSAAH 60

  Fly    72 CIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQ 134
            |.|.|    :.:..|:::|...|  ||.:...|:|.:..|:..|..:||.||...:|...:..||
Zfish    61 CYKSR----LEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWTIDSDIMLIKLSKPATLNKYVQ 121

  Fly   135 PIAVALEAPPSGAQAVVSGWG----KRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDE 195
            |:|:.......|....|||||    ..|:.::     |:.:|:.|:....|...|   ...:||.
Zfish   122 PVALPNGCAADGTMCRVSGWGNTMSSTADSNK-----LQCLEIPILSDRDCKNSY---PGMITDT 178

  Fly   196 MLCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254
            |.||||||||||:|.||||||:..:|.|.|:||||.||.::..||||..|.....||.:
Zfish   179 MFCAGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKDNPGVYGKVCMFSQWIAD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 84/230 (37%)
Tryp_SPc 28..255 CDD:238113 86/233 (37%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 84/230 (37%)
Tryp_SPc 21..238 CDD:238113 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.