DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and LOC100485189

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:255 Identity:90/255 - (35%)
Similarity:135/255 - (52%) Gaps:15/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAH 71
            ||:.|.||..:   .|.....|:||.:......|:..|:   .|...|:|||.:.....|:||||
 Frog     4 LFVSALLGTAV---QARYYDRIIGGTECRPNSQPWHCSL---YYFDQHVCGGVLIDENWVLTAAH 62

  Fly    72 CIKGRYASYIRIVAGQNSIADLE--EQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQ 134
            |    ..|.:::..|::::|..|  ||.....|:.||:|:|..|:.|||.|:....|:..:..||
 Frog    63 C----QLSSLQVRLGEHNLAVYEGKEQFSYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDYVQ 123

  Fly   135 PIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCA 199
            .|.:.......|...:|||||.....:|..|..|:.||:|.:.:..|...:.|.:  :||.||||
 Frog   124 TIPLGCPTVGDGETCLVSGWGTTTSPEETFPDELQCVEVQTVSQDYCQGAFPTDE--ITDNMLCA 186

  Fly   200 GYLEGGKDTCNGDSGGPLAVDGVLVGVVSWG-VGCGREGFPGVYTSVNSHIDWIEEQAEA 258
            |.:|||||:|.|||||||..:.::.|:.||| ..||....||:||.:.::|.||::...|
 Frog   187 GVMEGGKDSCQGDSGGPLVCNSMVHGITSWGNTPCGVANKPGIYTKICNYIAWIQDTIAA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 81/227 (36%)
Tryp_SPc 28..255 CDD:238113 83/229 (36%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 83/229 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3316
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 1 1.000 - - otm48708
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.