DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8299 and plaua

DIOPT Version :9

Sequence 1:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:255 Identity:76/255 - (29%)
Similarity:126/255 - (49%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 THIVGGDQADIADFPYQVSV-RLETYMLLHICGGSIYAPRVVITAAHCIK-------GRYASYIR 82
            |.|:||.::.:...|:..:: :.:.:    ||||::..|..|:|||||..       .||:    
Zfish   162 TKIIGGLRSTVESQPWMAAIFKGDGF----ICGGTLITPCWVLTAAHCFPTGKRTQINRYS---- 218

  Fly    83 IVAGQNSIAD---LEEQGVKVSKLIPHA--GYNKKTYVNDIGLI---------ITREPLEYSALV 133
            :|.|:|:|.:   ::||...||:|:.|.  .|:.:.|.:||.|:         ..:.....:|.:
Zfish   219 VVLGKNAINETDPVKEQKFTVSRLVIHEDFDYSTENYTHDIALLKIEDCNGQCAVKTKTVRTACL 283

  Fly   134 QPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLC 198
            .|....|   |.|....::|:|:..:........|:..|:::|.:..|...|..|| .|.:.|||
Zfish   284 PPFQQML---PVGFYCEIAGYGRYQKGTFKFSRYLKQTEVKLISQKVCQRTYYNKD-EVNENMLC 344

  Fly   199 AGYLEGGKDTCNGDSGGPLA--VDGV--LVGVVSWGVGCGREGFPGVYTSVNSHIDWIEE 254
            |...:...|.|.|||||||.  |:.:  |.|::|||..|..:..|||||.|:::..||.:
Zfish   345 ANGRDWKTDACQGDSGGPLVCEVNNIMFLFGIISWGKECAEKNQPGVYTQVSNYNQWISQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 73/250 (29%)
Tryp_SPc 28..255 CDD:238113 75/253 (30%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.