DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bug and APRL4

DIOPT Version :10

Sequence 1:NP_611065.1 Gene:bug / 36749 FlyBaseID:FBgn0034050 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_564452.1 Gene:APRL4 / 840382 AraportID:AT1G34780 Length:310 Species:Arabidopsis thaliana


Alignment Length:163 Identity:32/163 - (19%)
Similarity:66/163 - (40%) Gaps:49/163 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VASMVNVLPHYF--------PTLPIAYVDAYEFGRFNAEFGIVSLPTLMLFHQGRPLIKFEPGWK 202
            ::|:.:.:||:.        .||              :::|:...|||:|.:.     .....::
plant   106 ISSLYSSIPHFAIKESSIKPSTL--------------SKYGVHGFPTLLLLNS-----TMRARYR 151

  Fly   203 DTK--SSFASFIMSHTNMKTVNPQAID-----PIILTRAEMEPLSNKP---------IVQTDYYL 251
            .|:  .|..:|....|.::|::..:::     |.:......|| .|.|         :::.:.||
plant   152 GTRMLDSLVAFYSDVTGIETLDKTSLERSVSVPHLGNENNTEP-ENCPFTWARSPENMLRQETYL 215

  Fly   252 GLAWAFILVCLANFLRKTALWKQLVEMVQRIWR 284
            .||..|:|:.|.:.:..|     ||..::..||
plant   216 ALAIVFVLLRLLHLIYPT-----LVVFMKFTWR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bugNP_611065.1 CnoX 131..215 CDD:442352 13/78 (17%)
APRL4NP_564452.1 PDI_a_ERp44_like 64..163 CDD:239297 12/75 (16%)

Return to query results.
Submit another query.