DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and BIRC7

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_647478.1 Gene:BIRC7 / 79444 HGNCID:13702 Length:298 Species:Homo sapiens


Alignment Length:379 Identity:111/379 - (29%)
Similarity:155/379 - (40%) Gaps:110/379 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 DHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC-PRVQMGPLIEFATGKNLDE-----LG-IQPTT 202
            |..||:......:.|...|...:|      :| ||....|::...|.:..|.     || ::|.|
Human     5 DSAKCLHRGPQPSHWAAGDGPTQE------RCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLT 63

  Fly   203 L--------------PLRPKYACVDARLRTFTDWPISNIQPASALAQAGLYYQKIGDQVRCFHCN 253
            .              |..|.....:.||.:|.|||::...|...||.||.::....|:||||.|.
Human    64 EEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCY 128

  Fly   254 IGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAANASS-QPATAPAPTLQADVLM 317
            .||:||::.|:||.|||||.|.|||:|.:||..:|..|..|.:....| .|...|.         
Human   129 GGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPE--------- 184

  Fly   318 DEAPAKEALALGIDGGVVRNAIQRKLLSSGCAFSTLDELLHDIFDDAGAGAALEVREPPEPSAPF 382
            |.||.                                                   .|..|::.:
Human   185 DAAPV---------------------------------------------------APSVPASGY 198

  Fly   383 IE---PCQATTSKAASVPIPVADSIPAKPQAAEAVANISKITDEIQKMSVATPNGNLSLEEENRQ 444
            .|   |.:...|::|..|..|:   ||:.|.|               ..|..|.|...:|.:.|:
Human   199 PELPTPRREVQSESAQEPGGVS---PAEAQRA---------------WWVLEPPGARDVEAQLRR 245

  Fly   445 LKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFLS 498
            |::.|.||||||..|.:||:||||| .|.:|||.:..||:|||.::..||||||
Human   246 LQEERTCKVCLDRAVSIVFVPCGHL-VCAECAPGLQLCPICRAPVRSRVRTFLS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595 9/36 (25%)
BIR 213..281 CDD:237989 33/67 (49%)
UBA_IAPs 320..363 CDD:270506 2/42 (5%)
zf-C3HC4_3 447..492 CDD:290631 24/44 (55%)
BIRC7NP_647478.1 BIR 88..155 CDD:237989 33/66 (50%)
zf-C3HC4_3 248..292 CDD:290631 24/44 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140725
Domainoid 1 1.000 80 1.000 Domainoid score I8611
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 1 1.000 - - FOG0000512
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100552
Panther 1 1.100 - - O PTHR10044
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.