DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and birc5l

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001037948.1 Gene:birc5l / 733575 XenbaseID:XB-GENE-966741 Length:139 Species:Xenopus tropicalis


Alignment Length:75 Identity:30/75 - (40%)
Similarity:38/75 - (50%) Gaps:7/75 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 RLRTFTDWPISN---IQPASALAQAGLYY---QKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWS 273
            ||.||.:||.:.   ..| ..:|:||..:   ....|.|:||.|...|..||.||:|..||.|.|
 Frog    13 RLSTFANWPFTEDCACTP-ERMAEAGFVHCPSDNSPDVVKCFFCLKELEGWQPEDDPMDEHKKHS 76

  Fly   274 PKCQFVLLAK 283
            |.|.|:.|.|
 Frog    77 PSCLFIALKK 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989 28/71 (39%)
UBA_IAPs 320..363 CDD:270506
zf-C3HC4_3 447..492 CDD:290631
birc5lNP_001037948.1 BIR 13..82 CDD:306999 27/69 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.