DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and NLRC4

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001186067.1 Gene:NLRC4 / 58484 HGNCID:16412 Length:1024 Species:Homo sapiens


Alignment Length:444 Identity:80/444 - (18%)
Similarity:135/444 - (30%) Gaps:160/444 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 CSMVLAPNHCGNVPRSQESDN--EGNSVVDSPESCSCPDLLLEANRLVTFKDWPNPNITPQALAK 135
            |.:.|..........|||.:.  :|.|:..:  |.:.||.|.:     .|:..||       .|.
Human   557 CGIHLYQESTSKSALSQEFEAFFQGKSLYIN--SGNIPDYLFD-----FFEHLPN-------CAS 607

  Fly   136 AGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLIEFATGKNLDELGIQP 200
            |       ||.:|..:..|.:|.|||                      ..|...|.:::|  ...
Human   608 A-------LDFIKLDFYGGAMASWEK----------------------AAEDTGGIHMEE--APE 641

  Fly   201 TTLPLR---------PKYACVDARLRTFTDWPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGL 256
            |.:|.|         .::..::..||.|:.....:|:          |..||      |.....|
Human   642 TYIPSRAVSLFFNWKQEFRTLEVTLRDFSKLNKQDIR----------YLGKI------FSSATSL 690

  Fly   257 RSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAANASSQPATAPAPTLQAD------- 314
            |...|             :|      .|.|....::.:|..|..|....|...|::.:       
Human   691 RLQIK-------------RC------AGVAGSLSLVLSTCKNIYSLMVEASPLTIEDERHITSVT 736

  Fly   315 -------------------------------VLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGC 348
                                           ::||.....|..|:.:..|:       |.|...|
Human   737 NLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIMDNIKMNEEDAIKLAEGL-------KNLKKMC 794

  Fly   349 AFSTLDELLHDIFDDAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIPVADSIPAKPQAAEA 413
            .|    .|.|  ..|.|.|....|:....      |||.....:..|..:           :|.|
Human   795 LF----HLTH--LSDIGEGMDYIVKSLSS------EPCDLEEIQLVSCCL-----------SANA 836

  Fly   414 VANISKITDEIQKMSVATPNGNLSLEEENRQLKDARLCKVCLDEEVGVVFLPCG 467
            |..:::....:.|:|:...:.|. ||::..:.....:.::.:.|::..:.||.|
Human   837 VKILAQNLHNLVKLSILDLSENY-LEKDGNEALHELIDRMNVLEQLTALMLPWG 889

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989 1/4 (25%)
BIR 112..181 CDD:197595 13/68 (19%)
BIR 213..281 CDD:237989 12/67 (18%)
UBA_IAPs 320..363 CDD:270506 9/42 (21%)
zf-C3HC4_3 447..492 CDD:290631 4/21 (19%)
NLRC4NP_001186067.1 CARD 1..87 CDD:279013
Nucleotide-binding domain (NBD). /evidence=ECO:0000250 95..298
NACHT 163..316 CDD:283404
Winged-helix domain (WHD). /evidence=ECO:0000250 356..463
LRR 1 578..598 6/26 (23%)
LRR 2 656..679 4/32 (13%)
leucine-rich repeat 691..713 CDD:275381 6/40 (15%)
LRR 3 735..758 0/22 (0%)
LRR_RI 738..978 CDD:238064 31/183 (17%)
leucine-rich repeat 738..764 CDD:275380 0/25 (0%)
LRR 4 762..785 4/22 (18%)
leucine-rich repeat 765..789 CDD:275380 5/30 (17%)
LRR 5 787..812 9/37 (24%)
leucine-rich repeat 790..817 CDD:275380 9/32 (28%)
leucine-rich repeat 822..849 CDD:275380 4/37 (11%)
LRR 6 824..847 4/33 (12%)
LRR 7 848..870 5/22 (23%)
leucine-rich repeat 850..880 CDD:275380 4/30 (13%)
LRR 8 878..902 4/12 (33%)
leucine-rich repeat 881..908 CDD:275380 3/9 (33%)
leucine-rich repeat 909..938 CDD:275380
LRR 9 911..933
LRR 10 936..963
leucine-rich repeat 939..966 CDD:275380
LRR 11 965..985
LRR 12 999..1021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.