DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and NAIP

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001333799.1 Gene:NAIP / 4671 HGNCID:7634 Length:1403 Species:Homo sapiens


Alignment Length:353 Identity:98/353 - (27%)
Similarity:152/353 - (43%) Gaps:76/353 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MELESVRLATFGEWPLNAPVSAEDLVANGFFATGNWLEAECHFCHVRIDRWEYGDQVA----ERH 66
            |..|:.||.||..:...:....:::.|.||:.||.....:|..|.:.:    :|..:.    |.|
Human    57 MRSEAKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLIL----FGAGLTRLPIEDH 117

  Fly    67 RRSSPICSMVLAPNHCGNVP------RSQESDNEGNSVVDSPESCSCPDLLLEANRLVTFKDWP- 124
            :|..|.|..:|..: .||:.      ::.:|...|..:....|..          ||.:|::|| 
Human   118 KRFHPDCGFLLNKD-VGNIAKYDIRVKNLKSRLRGGKMRYQEEEA----------RLASFRNWPF 171

  Fly   125 -NPNITPQALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCPRVQMGPLIEFA 188
             ...|:|..|::|||.:..:.|.|:|..|.|.:..||:.|:.::||.::||:|         ||.
Human   172 YVQGISPCVLSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKC---------EFL 227

  Fly   189 TGKNLDE---------LGIQPTT------------LPLRPKYACVDA-------RLRTFTDWPIS 225
            ..|...|         .|....|            ||:...| |.|:       ||.:|.|||..
Human   228 RSKKSSEEITQYIQSYKGFVDITGEHFVNSWVQRELPMASAY-CNDSIFAYEELRLDSFKDWPRE 291

  Fly   226 NIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVS- 289
            :....:|||:|||:|..|.|.|:||.|...|..||:.|:|..:|.:..|.|.|:...|..|.|: 
Human   292 SAVGVAALAKAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKSSAEVTP 356

  Fly   290 ---------EVLATTA-ANASSQPATAP 307
                     |:|.||: :|.....|..|
Human   357 DLQSRGELCELLETTSESNLEDSIAVGP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989 17/69 (25%)
BIR 112..181 CDD:197595 24/70 (34%)
BIR 213..281 CDD:237989 29/74 (39%)
UBA_IAPs 320..363 CDD:270506
zf-C3HC4_3 447..492 CDD:290631
NAIPNP_001333799.1 BIR 1 60..127 18/70 (26%)
BIR 2 159..227 26/86 (30%)
BIR 3 278..345 27/66 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140726
Domainoid 1 1.000 80 1.000 Domainoid score I8611
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.