DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and Det

DIOPT Version :10

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_650608.1 Gene:Det / 42077 FlyBaseID:FBgn0264291 Length:153 Species:Drosophila melanogaster


Alignment Length:73 Identity:25/73 - (34%)
Similarity:39/73 - (53%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 RLRTFTDWPISNIQPA--SALAQAGLYY---QKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSP 274
            |:.::..||.......  |.:|:||.|:   ::..|...||.|...|..|:.||:||.||.|.:|
  Fly    31 RVESYKSWPFPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAP 95

  Fly   275 KCQFVLLA 282
            :|:|..|:
  Fly    96 QCEFAKLS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989 24/70 (34%)
UBA_IAPs 320..363 CDD:270506
RING-HC_BIRC2_3_7 442..498 CDD:438373
DetNP_650608.1 BIR 31..101 CDD:459891 24/69 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.