DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and Bruce

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster


Alignment Length:140 Identity:46/140 - (32%)
Similarity:65/140 - (46%) Gaps:31/140 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 RLRTFTDWPISNIQPA--SALAQAGLYYQKIG---DQVRCFHCNIGLRSWQKEDEPWFEHAKWSP 274
            |.:||..||..:.:.|  ..:||||.|:|...   |:..||.|::.|..|:|.||||.||.:.||
  Fly   251 RRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHSP 315

  Fly   275 KCQFVLLAKGPAYVSEVLATTAANASSQPATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAI 339
            .|.||   ||....:..|:.|.|   :.|| .|||                 .||.|  ::.|:.
  Fly   316 LCPFV---KGEYTQNVPLSITYA---TNPA-LPAP-----------------GLGFD--IISNSD 354

  Fly   340 QRKLLSSGCA 349
            ...:|.:.|:
  Fly   355 YANVLCTSCS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989 30/70 (43%)
UBA_IAPs 320..363 CDD:270506 6/30 (20%)
zf-C3HC4_3 447..492 CDD:290631
BruceNP_001262460.1 BIR 251..321 CDD:279047 30/72 (42%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438011
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.