DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and dnr1

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001261137.1 Gene:dnr1 / 37575 FlyBaseID:FBgn0260866 Length:696 Species:Drosophila melanogaster


Alignment Length:374 Identity:71/374 - (18%)
Similarity:122/374 - (32%) Gaps:128/374 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 SNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPA-YV 288
            |:..|:::.:|.||..:...:.:|.:             |.:|    ..|.|:    .:.|| |:
  Fly   248 SSSSPSNSSSQTGLDERLASNPLRVY-------------EEYF----MQPSCE----GEPPADYL 291

  Fly   289 SEVLATTAANASSQPATAPA---------------PTLQADVLMDEAPAKEALALGIDGGVVRNA 338
            .::.......|..|.:...|               ..|.:.|..:|:..:..:|:|..|..|...
  Fly   292 RQIAVEHGKLAKLQMSLKTAKYWLLKSIQDLEGYGEELFSGVTTNESATRCDIAVGAHGITVCRG 356

  Fly   339 IQRKLLSSGCAFSTLDELLH----DIFDDAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIP 399
            .:::.:..| |.:....|..    :..||......||::.|.:|.|..:  .::.|.:.|   ..
  Fly   357 GEKQSIPFG-AIAAAKSLRRTFKLEYVDDHNDRKELEIKLPKQPIAAGL--YRSITERHA---FY 415

  Fly   400 VADSI---------------------------------------PAKPQA------------AEA 413
            |.|.:                                       ....||            ||.
  Fly   416 VCDKVRGVVTNQFTRDLKGTIASMFMENTELGKRYVFDIQHTCREVHDQARRTLHERGGDLVAEG 480

  Fly   414 VANISKITDEIQKMSVATPN-----------------GNLSL---EEENRQ----------LKDA 448
            ....|.:...:...:|..|.                 |.:.|   |:|.|:          :.:|
  Fly   481 AEGCSAVAGGLGASAVGEPGVSPWAMALTTGAGGSMAGKIDLAIREKEAREAAIERCVDTRISEA 545

  Fly   449 RLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFL 497
            ..||:|:|..:..||.||.|:..|.|||...:|||.||..|...|:.:|
  Fly   546 MQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYL 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989 10/55 (18%)
UBA_IAPs 320..363 CDD:270506 7/46 (15%)
zf-C3HC4_3 447..492 CDD:290631 20/44 (45%)
dnr1NP_001261137.1 B41 3..>143 CDD:214604
FERM_N 5..67 CDD:286467
FERM_M 93..>143 CDD:278785
FERM_C_MYLIP_IDOL 325..435 CDD:270016 21/115 (18%)
zf-C3HC4_3 544..589 CDD:290631 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340284at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.