DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and Birc6

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001164067.1 Gene:Birc6 / 313876 RGDID:1307247 Length:4865 Species:Rattus norvegicus


Alignment Length:344 Identity:85/344 - (24%)
Similarity:131/344 - (38%) Gaps:58/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 ELGIQPTTLPLRPKYACVDARLRTFTDWPISN---IQPASALAQAGLYYQKIG---DQVRCFHCN 253
            |||:.|.....|........|..|||.||...   .|| ..:||||.|:|...   |:..||.|:
  Rat   272 ELGVGPGRSVDRALMYSEANRRETFTSWPHVGYRWAQP-DPMAQAGFYHQPASSGDDRAMCFTCS 335

  Fly   254 IGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAANASSQ---------------- 302
            :.|..|:..||||.||.:.||.|.||   ||....:..|:.|.|.:.:|                
  Rat   336 VCLVCWEPTDEPWSEHERHSPNCPFV---KGEHTQNVPLSVTLATSPAQLPSADGADRISCFGSG 397

  Fly   303 --PATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAFSTLDE------LLHD 359
              |....|.|.:..:.:.:......:.|..:.......|.::|:.||...|.:|.      .|.|
  Rat   398 SCPQFLAAATKRGKICIWDVSKLMKVHLKFEINAYDPVIVQQLILSGDPSSGVDSRRPTLAWLED 462

  Fly   360 IFD-------DAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIPV-ADSIPAKPQAA--EAV 414
            ...       :..:...||..:..|.|.........:..:|..|.:.: |.||..:|:..  |.|
  Rat   463 SSSCSDIPKLEGDSDDLLEDSDSEEHSRSDSVTGHTSQKEAMEVSLDITALSILQQPEKLQWEIV 527

  Fly   415 ANISKITDEIQKMSVATPNGNLSLEEENRQLKDARLCKVCLDEEVGVVFLPC---GHLATCNQCA 476
            ||:  :.|.::.:.....|..|: ..::.:.|:..      .|:..:.| ||   |.|.|....|
  Rat   528 ANV--LEDTVKDLEELGANPCLT-NSKSEKTKEKH------QEQHNIPF-PCLLAGGLLTYKSPA 582

  Fly   477 PSVANCPMCRADIKGFVRT 495
            .|..:....|: :.|..||
  Rat   583 TSPISSNSHRS-LDGLSRT 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989 31/73 (42%)
UBA_IAPs 320..363 CDD:270506 9/55 (16%)
zf-C3HC4_3 447..492 CDD:290631 10/47 (21%)
Birc6NP_001164067.1 BIR 290..363 CDD:237989 31/76 (41%)
DUF3643 3472..3624 CDD:289152
UBCc 4605..4743 CDD:238117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.