powered by:
Protein Alignment Diap2 and MYLIP
DIOPT Version :9
Sequence 1: | NP_477127.1 |
Gene: | Diap2 / 36748 |
FlyBaseID: | FBgn0015247 |
Length: | 498 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_037394.2 |
Gene: | MYLIP / 29116 |
HGNCID: | 21155 |
Length: | 445 |
Species: | Homo sapiens |
Alignment Length: | 60 |
Identity: | 25/60 - (41%) |
Similarity: | 38/60 - (63%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 438 LEEENRQLKDARLCKVCLDEEVGVVFLPCGHLATCNQCAPSVANCPMCRADIKGFVRTFL 497
|:|:.|:||:|.||.||.:||:...|.||||...|..||..:.:||:||:.::.....:|
Human 374 LQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYL 433
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1340284at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.