DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and birc5b

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_660196.1 Gene:birc5b / 246726 ZFINID:ZDB-GENE-030826-2 Length:128 Species:Danio rerio


Alignment Length:76 Identity:28/76 - (36%)
Similarity:43/76 - (56%) Gaps:5/76 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 DARLRTFTDWPI-SNIQ-PASALAQAGLYY---QKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKW 272
            :.||:||::||. .:.| ....:|:||..:   :...|...||:|...|..|:.:|.||.||||.
Zfish     5 EKRLQTFSEWPFREDCQCTPELMAKAGFVHCPSENEPDVACCFYCLRELEGWEPDDNPWSEHAKR 69

  Fly   273 SPKCQFVLLAK 283
            ||.|.|:.::|
Zfish    70 SPNCAFLHMSK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989 27/72 (38%)
UBA_IAPs 320..363 CDD:270506
zf-C3HC4_3 447..492 CDD:290631
birc5bNP_660196.1 BIR 7..77 CDD:279047 27/69 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573441
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.