DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and bir-2

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_506362.1 Gene:bir-2 / 179841 WormBaseID:WBGene00000250 Length:308 Species:Caenorhabditis elegans


Alignment Length:210 Identity:54/210 - (25%)
Similarity:92/210 - (43%) Gaps:46/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LNAPVSAEDLVANGFFATGN---WLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMV------ 76
            :|...::|.|...||::|.:   ...|:|.||.:.|: :|..|...|:|:..||.|..|      
 Worm    40 INIACTSEKLARAGFYSTASPEFPASAKCPFCMLEIN-FEQCDDPWEKHKSGSPHCEFVMIGEIE 103

  Fly    77 -----------LAPNHC---------GNVPRSQESDNEGNSVVDSPESC-------SCPDLLLEA 114
                       ||..|.         |.|...:..|....:.:...::.       |...||...
 Worm   104 ESELSFRIISNLAIRHATVRLYEELLGIVATLENGDIANENPITRADATRKLISFRSSSKLLTFD 168

  Fly   115 NRLVTFKDW-----PNPNITPQALAKAGFYYL-NRLD--HVKCVWCNGVIAKWEKNDNAFEEHKR 171
            :||.||:::     .|...|.:.|||||::.: |:.|  ..||.:|. |...::::|:.:|||::
 Worm   169 HRLATFQNFIFDKKRNVKCTSKKLAKAGWFSIANKKDKTSAKCPFCL-VELDFDESDDPWEEHQK 232

  Fly   172 FFPQCPRVQMGPLIE 186
            |...|..:::|.|.|
 Worm   233 FSASCDFIKLGKLDE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989 19/76 (25%)
BIR 112..181 CDD:197595 23/76 (30%)
BIR 213..281 CDD:237989
UBA_IAPs 320..363 CDD:270506
zf-C3HC4_3 447..492 CDD:290631
bir-2NP_506362.1 BIR 23..99 CDD:197595 19/59 (32%)
BIR 166..242 CDD:197595 23/76 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166936
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I3865
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 1 1.000 - - X559
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.