DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and bir-1

DIOPT Version :10

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_505949.1 Gene:bir-1 / 179597 WormBaseID:WBGene00000249 Length:155 Species:Caenorhabditis elegans


Alignment Length:81 Identity:29/81 - (35%)
Similarity:39/81 - (48%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 KYACVDARLRTFTDWPISNIQPA----SALAQAGLYYQKIGDQV-RCFHCNIGLRSWQKEDEPWF 267
            |:.....||.||.::.......|    .|:||||.|.  .|.|. :|..||..| .:..||:||:
 Worm    13 KFTFYKDRLMTFKNFEYDRDPDAKCTSQAVAQAGFYC--TGPQSGKCAFCNKEL-DFDPEDDPWY 74

  Fly   268 EHAKWSPKCQFVLLAK 283
            ||.|....|:||.:.|
 Worm    75 EHTKRDEPCEFVRIGK 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989 27/72 (38%)
UBA_IAPs 320..363 CDD:270506
RING-HC_BIRC2_3_7 442..498 CDD:438373
bir-1NP_505949.1 BIR 16..88 CDD:197595 27/74 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.