DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and exc-14

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_504354.1 Gene:exc-14 / 178892 WormBaseID:WBGene00019649 Length:400 Species:Caenorhabditis elegans


Alignment Length:131 Identity:33/131 - (25%)
Similarity:55/131 - (41%) Gaps:30/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PIPVADSIPAKPQ-----AAEAVANIS-------KITDEIQKMSVATPNGNLSL----EEENRQL 445
            |:.:.|.:..|..     :.|.:.||:       ::.:...::........||:    ||...||
 Worm   270 PLVLLDELTKKHSQLVDLSTEFLPNINAVKMLYKELFESFPQLETNVHESKLSMERRVEEVEEQL 334

  Fly   446 KD-----ARL-------CKVCLDEEVGVVFLPCGHLATCNQC--APSVANCPMCRADIKGFVRTF 496
            :.     .||       |.:||..:..:||:||.||.||:.|  |.....||.||:.|:..:..|
 Worm   335 RSRNRDFQRLQEKLVAECCICLATKPSIVFMPCRHLITCSGCYDASDFRECPTCRSTIENSITVF 399

  Fly   497 L 497
            :
 Worm   400 M 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989
UBA_IAPs 320..363 CDD:270506
zf-C3HC4_3 447..492 CDD:290631 20/58 (34%)
exc-14NP_504354.1 Smc <112..>272 CDD:224117 1/1 (100%)
zf-C3HC4_3 351..393 CDD:372816 17/41 (41%)
RING-HC finger (C3HC4-type) 352..388 CDD:319361 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D547697at33208
OrthoFinder 1 1.000 - - FOG0000512
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.