DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and Birc6

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_006523581.1 Gene:Birc6 / 12211 MGIID:1276108 Length:4953 Species:Mus musculus


Alignment Length:344 Identity:86/344 - (25%)
Similarity:133/344 - (38%) Gaps:58/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 ELGIQPTTLPLRPKYACVDARLRTFTDWPISN---IQPASALAQAGLYYQKIG---DQVRCFHCN 253
            |||:.|.....|........|..|||.||...   .|| ..:||||.|:|...   |:..||.|:
Mouse   329 ELGVGPGRSVDRALMYSEANRRETFTSWPHVGYRWAQP-DPMAQAGFYHQPASSGDDRAMCFTCS 392

  Fly   254 IGLRSWQKEDEPWFEHAKWSPKCQFVLLAKGPAYVSEVLATTAANASSQ---------------- 302
            :.|..|:..||||.||.:.||.|.||   ||....:..|:.|.|.:.:|                
Mouse   393 VCLVCWEPTDEPWSEHERHSPNCPFV---KGEHTQNVPLSVTLATSPAQLPSADGADRIACFGSG 454

  Fly   303 --PATAPAPTLQADVLMDEAPAKEALALGIDGGVVRNAIQRKLLSSGCAFSTLDE------LLHD 359
              |....|.|.:..:.:.:......:.|..:......||.::|:.||...|.:|.      .|.|
Mouse   455 SCPQFLAAATKRGKICIWDVSKLMKVHLKFEINAYDPAIVQQLILSGDPSSGVDSRRPTLAWLED 519

  Fly   360 IFD-------DAGAGAALEVREPPEPSAPFIEPCQATTSKAASVPIPV-ADSIPAKPQAA--EAV 414
            ...       :..:...||..:..|.|.........:..:|..|.:.: |.||..:|:..  |.|
Mouse   520 SSSCSDIPKLEGDSDDLLEDSDSEEHSRSDSVTGHTSQKEAMEVSLDITALSILQQPEKLQWEIV 584

  Fly   415 ANISKITDEIQKMSVATPNGNLSLEEENRQLKDARLCKVCLDEEVGVVFLPC---GHLATCNQCA 476
            ||:  :.|.::.:.....|.:|: ..::.:.|:..      .|:..:.| ||   |.|.|....|
Mouse   585 ANV--LEDTVKDLEELGANPSLT-NSKSEKTKEKH------QEQHNIPF-PCLLAGGLLTYKSPA 639

  Fly   477 PSVANCPMCRADIKGFVRT 495
            .|..:....|: :.|..||
Mouse   640 TSPISSNSHRS-LDGLSRT 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595
BIR 213..281 CDD:237989 31/73 (42%)
UBA_IAPs 320..363 CDD:270506 10/55 (18%)
zf-C3HC4_3 447..492 CDD:290631 10/47 (21%)
Birc6XP_006523581.1 BIR 347..420 CDD:237989 31/76 (41%)
BIRC6 3558..3712 CDD:372067
UBCc 4693..4831 CDD:238117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.