DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and Birc5

DIOPT Version :9

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_033819.1 Gene:Birc5 / 11799 MGIID:1203517 Length:140 Species:Mus musculus


Alignment Length:96 Identity:32/96 - (33%)
Similarity:49/96 - (51%) Gaps:16/96 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LLLEANRLVTFKDWP---NPNITPQALAKAGFYYL---NRLDHVKCVWCNGVIAKWEKNDNAFEE 168
            |.|:..|:.|||:||   :...||:.:|:|||.:.   |..|..:|.:|...:..||.:||..||
Mouse    12 LYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEE 76

  Fly   169 HKRFFPQCPRVQMGPLIEFAT-GKNLDELGI 198
            |::..|.|         .|.| .|.::||.:
Mouse    77 HRKHSPGC---------AFLTVKKQMEELTV 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595 26/74 (35%)
BIR 213..281 CDD:237989
UBA_IAPs 320..363 CDD:270506
zf-C3HC4_3 447..492 CDD:290631
Birc5NP_033819.1 BIR 18..88 CDD:279047 26/78 (33%)
BIR 18..88 26/78 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830698
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.