DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Diap2 and Birc5

DIOPT Version :10

Sequence 1:NP_477127.1 Gene:Diap2 / 36748 FlyBaseID:FBgn0015247 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_033819.1 Gene:Birc5 / 11799 MGIID:1203517 Length:140 Species:Mus musculus


Alignment Length:96 Identity:32/96 - (33%)
Similarity:49/96 - (51%) Gaps:16/96 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LLLEANRLVTFKDWP---NPNITPQALAKAGFYYL---NRLDHVKCVWCNGVIAKWEKNDNAFEE 168
            |.|:..|:.|||:||   :...||:.:|:|||.:.   |..|..:|.:|...:..||.:||..||
Mouse    12 LYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEE 76

  Fly   169 HKRFFPQCPRVQMGPLIEFAT-GKNLDELGI 198
            |::..|.|         .|.| .|.::||.:
Mouse    77 HRKHSPGC---------AFLTVKKQMEELTV 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Diap2NP_477127.1 BIR 12..78 CDD:237989
BIR 112..181 CDD:197595 26/74 (35%)
BIR 213..281 CDD:237989
UBA_IAPs 320..363 CDD:270506
RING-HC_BIRC2_3_7 442..498 CDD:438373
Birc5NP_033819.1 BIR 18..88 CDD:459891 26/78 (33%)
BIR 18..88 26/78 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..140
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.