DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdg and ZDS1

DIOPT Version :9

Sequence 1:NP_611064.2 Gene:bdg / 36747 FlyBaseID:FBgn0034049 Length:1331 Species:Drosophila melanogaster
Sequence 2:NP_014000.1 Gene:ZDS1 / 855316 SGDID:S000004886 Length:915 Species:Saccharomyces cerevisiae


Alignment Length:565 Identity:108/565 - (19%)
Similarity:185/565 - (32%) Gaps:190/565 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SSLPPTGTGAGCSGAALGSGTGTGKRARSKQHQLEHEQFGLSNSLSSESIRQACAYYDDELSDED 85
            |::|...|......::|........|.||::.:.|.||          |:        ||:.::|
Yeast   347 SNMPINNTMTWPERSSLRRSRFNTYRIRSQEQEKEVEQ----------SV--------DEMKNDD 393

  Fly    86 -----------LIEIQQTPQAFHQQTKQPLQL-QPISFRLGD-----------------ELGDER 121
                       .:||......|.||.:....: .|.|  :||                 |:|.|:
Yeast   394 EERLKLTKNTIKVEIDPHKSPFRQQDEDSENMSSPGS--IGDFQDIYNHYRQSSGEWEQEMGIEK 456

  Fly   122 SAFCGSQEMQQVPLSTPIKQAAETDEALCVLSELDAILDVHDVSQLNGTCSSGSVNSGSDDDKVE 186
                   |.::|    |:|...:|.|              .|:....||  :..|...:.||..|
Yeast   457 -------EAEEV----PVKVRNDTVE--------------QDLELREGT--TDMVKPSATDDNKE 494

  Fly   187 DYLMDLDNYLEEMDNALNREDSLIIIDGHTSLKREPRTRTLPLSRKKK--------------SSK 237
            .......|....::|.::|||......|....:....::.:.|...||              |:|
Yeast   495 TKRHRRRNGWTWLNNKMSREDDNEENQGDDENEENVDSQRMELDNSKKHYISLFNGGEKTEVSNK 559

  Fly   238 KKSEDQEAAQGDFQREHQLRKTFSCSLRPT---SQIASSSGSLETSTEPVMD----VWRRQSMRR 295
            ::..:...:....|...::.|||:...|..   ...||||.|...|:.|.:.    |..|....:
Yeast   560 EEMNNSSTSTATSQTRQKIEKTFANLFRRKPHHKHDASSSPSSSPSSSPSIPNNDAVHVRVRKSK 624

  Fly   296 ALEQEDTKATVAMEREEDDIPTLLVELP-PRRDAEMRRCFSQGDCQASVAPTVGSQMLTEAHIFD 359
            .|..:..:..|.        |.:|...| |.|....|.               |||.::...:.|
Yeast   625 KLGNKSGREPVE--------PIVLRNRPRPHRHHHSRH---------------GSQKISVKTLKD 666

  Fly   360 NLLQTNARASSEEPRPRQYGRRLEGPPTPVRPLIL------------AQSRPQSAP------TRV 406
            :             :|:|        ..|::|.:.            ::|.||..|      |:.
Yeast   667 S-------------QPQQ--------QIPLQPQLEGAIEIEKKEESDSESLPQLQPAVSVSSTKS 710

  Fly   407 QMREPQLQDT-PTHPIMSTCSELSSARSSR-------------MPSP------VSLPSDSSSSGS 451
            ..|:.:.::. ..:...|..:|:|:.:.|:             :.:|      .|:|..:|:...
Yeast   711 NSRDREEEEAKKKNKKRSNTTEISNQQHSKHVQKENTDEQKAQLQAPAQEQVQTSVPVQASAPVQ 775

  Fly   452 SSAEHDQEPDPVQTTTMCSASSTT---PLEPLHQLQLLLREKCGF 493
            :||       ||||:....||:.|   ...||....:|...|..|
Yeast   776 NSA-------PVQTSAPVEASAQTQAPAAPPLKHTSILPPRKLTF 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdgNP_611064.2 SLC5-6-like_sbd 501..976 CDD:271356
ZDS1NP_014000.1 tatB <732..809 CDD:166942 19/83 (23%)
Zds_C 845..893 CDD:370018
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.