DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdg and IRR1

DIOPT Version :9

Sequence 1:NP_611064.2 Gene:bdg / 36747 FlyBaseID:FBgn0034049 Length:1331 Species:Drosophila melanogaster
Sequence 2:NP_012238.1 Gene:IRR1 / 854786 SGDID:S000001288 Length:1150 Species:Saccharomyces cerevisiae


Alignment Length:180 Identity:35/180 - (19%)
Similarity:65/180 - (36%) Gaps:48/180 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DELGDERSAFCGSQEMQQVPLSTPIKQAAETDEALCVLSELDAILDVHDVSQLNGTCSSGSVNSG 179
            ::..||::......|..::...|..::..|.|                          :|.....
Yeast    19 EDYDDEQNTSAQHVESDKITAKTQHEEEEEQD--------------------------TGESEES 57

  Fly   180 SDDDKVEDYLMDLDNYLEEMDNALNREDSLIIIDGHTSLKREPRTRTLPLSRKKKSSKKKSEDQE 244
            |.:|..||  .|.|:|   :|.|..:         ..|.||:|::.:...|:::|  ||.:..|:
Yeast    58 SSEDDYED--QDDDDY---VDTATAK---------RKSRKRKPKSASNTSSKRQK--KKPTSAQK 106

  Fly   245 AAQGDFQREHQLRK------TFSCSLRPTSQIASSSGSLETSTEPVMDVW 288
            :|.......|:.:|      ..:...:||......|.|.:.|.|.::..|
Yeast   107 SAVSHAPAYHRSKKDQDQYLEIAKDFQPTELFDILSTSEDVSIEELLREW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdgNP_611064.2 SLC5-6-like_sbd 501..976 CDD:271356
IRR1NP_012238.1 IRR1 74..881 CDD:227824 20/94 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.