DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdg and Pcl

DIOPT Version :9

Sequence 1:NP_611064.2 Gene:bdg / 36747 FlyBaseID:FBgn0034049 Length:1331 Species:Drosophila melanogaster
Sequence 2:NP_001261067.1 Gene:Pcl / 37069 FlyBaseID:FBgn0003044 Length:1043 Species:Drosophila melanogaster


Alignment Length:204 Identity:52/204 - (25%)
Similarity:71/204 - (34%) Gaps:77/204 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 QASVAPTVGSQMLTEAHIFDNLLQTNARASSEEPRPRQYGRRLEGPP-TPVRPLILAQSRPQSAP 403
            |:...|:.|.|  |...|  |||..:..           |::|:.|| .||       :...|.|
  Fly   144 QSYYLPSGGGQ--TAGQI--NLLAASGT-----------GKQLQPPPLVPV-------TNSTSPP 186

  Fly   404 TRVQMREPQL------QDTPTHPIMSTCSELSSARSSRMPSPV--------------SLPSDSSS 448
            :.|.:....:      .:|||       |..||..:::.|||:              |..:||||
  Fly   187 STVVLDRINICINNHYTETPT-------SLSSSLTTAQQPSPIIPAIQHKAILPLIDSSTADSSS 244

  Fly   449 SGSSSAEHD---------------QEPDPVQTT---------TMCSASSTTPLEPLHQLQLLLRE 489
            ..|||....               .|||...||         .|.|...::|..||...|.||: 
  Fly   245 CSSSSVSSSSYSGTATTSAAVVIVDEPDSTTTTPQTPPTTPEAMSSPGKSSPSPPLLATQSLLK- 308

  Fly   490 KCGFNSQWP 498
              |.||..|
  Fly   309 --GVNSMKP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdgNP_611064.2 SLC5-6-like_sbd 501..976 CDD:271356
PclNP_001261067.1 TUDOR 350..399 CDD:197660
PHD_SF 426..469 CDD:304600
PHD2_MTF2_PHF19_like 514..565 CDD:276978
Mtf2_C 985..1032 CDD:290768
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.