DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdg and Y43D4A.1

DIOPT Version :9

Sequence 1:NP_611064.2 Gene:bdg / 36747 FlyBaseID:FBgn0034049 Length:1331 Species:Drosophila melanogaster
Sequence 2:NP_502983.2 Gene:Y43D4A.1 / 189850 WormBaseID:WBGene00012787 Length:91 Species:Caenorhabditis elegans


Alignment Length:104 Identity:29/104 - (27%)
Similarity:43/104 - (41%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 SSRMPSPVS--LPSDSSSSGSSSAEHDQEPDPVQTTTMCSASSTTPLEPLHQLQLLLREKCGFNS 495
            |.||.||..  .|||      |||..||.   :.||.:..:.|:..:|...      .:.|  ..
 Worm     5 SERMTSPTQRRSPSD------SSAAEDQR---IATTIVRDSGSSKEIEESQ------ADPC--RG 52

  Fly   496 QWPHAGSRTLALIGCTLGVFNMCRFAVLTINFGGNFLLQ 534
            .|.:.....|:.:|..:|:.|:.||.....|.||:..|:
 Worm    53 AWGNQIEFLLSTLGMAVGLGNIWRFPTRAYNNGGSAFLE 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdgNP_611064.2 SLC5-6-like_sbd 501..976 CDD:271356 10/34 (29%)
Y43D4A.1NP_502983.2 SLC5-6-like_sbd 52..>90 CDD:294310 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.