DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bdg and SLC6A14

DIOPT Version :10

Sequence 1:NP_611064.2 Gene:bdg / 36747 FlyBaseID:FBgn0034049 Length:1331 Species:Drosophila melanogaster
Sequence 2:NP_009162.1 Gene:SLC6A14 / 11254 HGNCID:11047 Length:642 Species:Homo sapiens


Alignment Length:43 Identity:13/43 - (30%)
Similarity:17/43 - (39%) Gaps:5/43 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TTNTTTTTTAAETLVS--PTAEERS---NRSGKQQPITLILPT 45
            ||...:|......|.|  ||....|   :|.|.|..:|...|:
Human    79 TTREPSTERRLRPLCSQQPTVRSVSPFGHRPGMQCAVTTPPPS 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bdgNP_611064.2 SLC5-6-like_sbd 501..976 CDD:271356
SLC6A14NP_009162.1 SLC6sbd_ATB0 36..641 CDD:271391 13/43 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..642
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.