DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sli and Lrfn3

DIOPT Version :9

Sequence 1:NP_001261017.1 Gene:sli / 36746 FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:NP_780687.1 Gene:Lrfn3 / 233067 MGIID:2442512 Length:626 Species:Mus musculus


Alignment Length:631 Identity:136/631 - (21%)
Similarity:192/631 - (30%) Gaps:252/631 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLILPILLLLRHDAVHAEPYSGGFGSSAVSSGGLGSVGIHIPGGGVGVITEARCPRVCSC----T 80
            :.:||:||.|...|..:.|     ...|:||                     .|||.|.|    .
Mouse     1 MAVLPLLLCLLPLAPASSP-----PQPAISS---------------------PCPRRCRCQTQSM 39

  Fly    81 GLNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQ 145
            .|:|.|...||..||..:.                     :|..:||   |.||.|..:.|   :
Mouse    40 PLSVLCPGAGLLFVPPSLD---------------------RRAAELR---LADNFIAAVRR---R 77

  Fly   146 DLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITC 210
            ||.::                     ..||.|.:|.|.|..|....|...::||:|.||.|::|.
Mouse    78 DLANM---------------------TGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLTS 121

  Fly   211 LDEHAFKGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSATRL 275
            |.|...:|||.|..|.|:||.|.:|                                        
Mouse   122 LGEGQLRGLVNLRHLILSNNQLAAL---------------------------------------- 146

  Fly   276 APYTRCQSPSQLKGQNVADLHDQEFKCSGLTEHAPMECGAENSCPHPCRCADGIVDCREKSLTSV 340
                                                             .|..:.||.|      
Mouse   147 -------------------------------------------------AAGALDDCAE------ 156

  Fly   341 PVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNK 405
              ||.|                            :|||.||:.::..:||..|..:.||.|..|.
Mouse   157 --TLED----------------------------LDLSYNNLEQLPWEALGRLGNVNTLGLDHNL 191

  Fly   406 IKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKT 470
            :..:|:|.|..|..|..|.:.:|.::.|..|..     .|.|.|......|.|        |...
Mouse   192 LASVPAGAFSRLHKLARLDMTSNRLTTIPPDPL-----FSRLPLLARPRGSPA--------SALV 243

  Fly   471 VHLAKNPFICDCNLRWLADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLSG 535
            :....||..|:|.|.||.....::.:|.    |.||..:..|...::.||:|.|....:..: |.
Mouse   244 LAFGGNPLHCNCELVWLRRLAREDDLEA----CASPPALGGRYFWAVGEEEFVCEPPVVTHR-SP 303

  Fly   536 ECRMDSDCPAMCHCEGT--------TVDCTGR--GLKEIPRDIPLHTTELLLNDNELGRISSDGL 590
            ...:.:..||...|...        .|...||  |.....|..|..|.|||:.:.|.|     |.
Mouse   304 PLAVPAGRPAALRCRAVGDPEPRVRWVSPQGRLLGNSSRARAFPNGTLELLVTEPEDG-----GT 363

  Fly   591 FGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISN 636
            |                |.|..||...|:...||.:|.....:::|
Mouse   364 F----------------TCIAANAAGEATAAVELTVGPPPPPQLAN 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 LRRNT 73..103 CDD:214470 12/33 (36%)
leucine-rich repeat 83..104 CDD:275380 6/20 (30%)
LRR_8 102..160 CDD:290566 10/57 (18%)
leucine-rich repeat 105..125 CDD:275380 1/19 (5%)
LRR_RI <119..259 CDD:238064 37/139 (27%)
leucine-rich repeat 126..149 CDD:275380 9/22 (41%)
LRR_8 149..208 CDD:290566 14/58 (24%)
leucine-rich repeat 150..173 CDD:275380 0/22 (0%)
leucine-rich repeat 174..197 CDD:275380 8/22 (36%)
LRR_8 197..256 CDD:290566 19/58 (33%)
leucine-rich repeat 198..221 CDD:275380 11/22 (50%)
leucine-rich repeat 222..245 CDD:275380 7/22 (32%)
leucine-rich repeat 246..371 CDD:275380 7/124 (6%)
LRRCT 254..303 CDD:214507 0/48 (0%)
LRRNT 319..350 CDD:214470 7/30 (23%)
LRR_8 349..406 CDD:290566 12/56 (21%)
LRR_4 371..411 CDD:289563 12/39 (31%)
leucine-rich repeat 372..395 CDD:275380 8/22 (36%)
leucine-rich repeat 396..415 CDD:275380 6/18 (33%)
leucine-rich repeat 420..443 CDD:275380 5/22 (23%)
leucine-rich repeat 444..465 CDD:275380 5/20 (25%)
leucine-rich repeat 468..480 CDD:275378 2/11 (18%)
LRRCT 476..525 CDD:214507 15/48 (31%)
leucine-rich repeat 484..545 CDD:275380 13/60 (22%)
LRRNT 542..574 CDD:214470 10/41 (24%)
leucine-rich repeat 552..570 CDD:275380 5/27 (19%)
leucine-rich repeat 572..596 CDD:275380 8/23 (35%)
LRR_RI <574..>678 CDD:238064 16/63 (25%)
LRR_8 595..655 CDD:290566 9/42 (21%)
leucine-rich repeat 597..620 CDD:275380 5/22 (23%)
leucine-rich repeat 621..644 CDD:275380 4/16 (25%)
leucine-rich repeat 645..668 CDD:275380
leucine-rich repeat 669..756 CDD:275380
LRRCT 677..726 CDD:214507
LRRNT 739..770 CDD:214470
leucine-rich repeat 757..791 CDD:275380
LRR_4 770..807 CDD:289563
LRR_8 790..850 CDD:290566
LRR_4 791..830 CDD:289563
leucine-rich repeat 792..815 CDD:275380
LRR_4 814..863 CDD:289563
leucine-rich repeat 816..839 CDD:275380
leucine-rich repeat 840..861 CDD:275380
LRRCT 872..920 CDD:214507
EGF 935..966 CDD:278437
EGF_CA 971..1007 CDD:238011
EGF_CA 1009..1045 CDD:238011
EGF_CA 1055..1086 CDD:238011
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
Lrfn3NP_780687.1 LRR <63..>222 CDD:227223 63/310 (20%)
leucine-rich repeat 63..84 CDD:275380 9/47 (19%)
LRR 1 84..105 8/20 (40%)
leucine-rich repeat 85..108 CDD:275380 8/22 (36%)
LRR 2 108..129 9/20 (45%)
leucine-rich repeat 109..132 CDD:275380 11/22 (50%)
LRR 3 132..153 8/109 (7%)
leucine-rich repeat 133..157 CDD:275380 11/120 (9%)
LRR 4 157..178 10/48 (21%)
leucine-rich repeat 158..181 CDD:275380 10/50 (20%)
LRR 5 181..202 7/20 (35%)
leucine-rich repeat 182..205 CDD:275380 8/22 (36%)
LRR 6 205..226 5/25 (20%)
leucine-rich repeat 206..230 CDD:275380 7/28 (25%)
leucine-rich repeat 242..253 CDD:275378 2/10 (20%)
TPKR_C2 249..>281 CDD:326558 11/35 (31%)
Ig 310..383 CDD:325142 24/93 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..425 2/12 (17%)
fn3 425..502 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..626
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.