DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sli and ECM2

DIOPT Version :9

Sequence 1:NP_001261017.1 Gene:sli / 36746 FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:NP_001384.1 Gene:ECM2 / 1842 HGNCID:3154 Length:699 Species:Homo sapiens


Alignment Length:428 Identity:120/428 - (28%)
Similarity:185/428 - (43%) Gaps:68/428 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 DLHDQEFKCSG----LTEHAPMECGAENS--CPHPCRCADGIVDCREKSLTSVPVTLPDDTTELR 352
            |..|:|....|    :...:|:......:  .|..|..:...:.|....||.:|.......|.|.
Human   285 DEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLE 349

  Fly   353 LEQNFITELPPKSFSSFRRLRRIDLSNNNI--SRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFK 415
            |..|.|..:|.::|:....|.|:|||.|||  |.|...|...||:|..|.:.||.:..:||.:  
Human   350 LTGNSIASIPDEAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQL-- 412

  Fly   416 GLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSLANG---TFDAMKSIKTVHLAKNP 477
             ..:|:.|.:|.|.:..|.:::..||:.|..|.|..||: |.||.   .|..:||:..:.|.||.
Human   413 -PSTLEELKVNENNLQAIDEESLSDLNQLVTLELEGNNL-SEANVNPLAFKPLKSLAYLRLGKNK 475

  Fly   478 F-ICDCNLRWLAD--YLHKNPIETSGARCESPKRMHRRRIE--SLREEKFKCSWDELRMKLSGEC 537
            | |....|....:  ||..|.||.....|.:    |.|:|.  .||..|.    :|.|:      
Human   476 FRIIPQGLPGSIEELYLENNQIEEITEICFN----HTRKINVIVLRYNKI----EENRI------ 526

  Fly   538 RMDSDCP-AMCHCEG-TTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRL-PHLVK 599
                 .| |..:.|. .::|.:...|..:|..:|.....|:|..|::.||.. .:||.: |.|..
Human   527 -----APLAWINQENLESIDLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPG-YVFGHMEPGLEY 585

  Fly   600 LELKRNQLT--GIEPNAFEGASH-IQELQLGENKIKEISNKMFLGLHQLKTLN---LYDNQISCV 658
            |.|..|:|.  |::..:|.||.| ::||.|..|.:|.|..    |:.::|.|:   |.:|:|..:
Human   586 LYLSFNKLADDGMDRVSFYGAYHSLRELFLDHNDLKSIPP----GIQEMKALHFLRLNNNKIRNI 646

  Fly   659 MP-----------GSFEHL----NSLTSLNLASNPFNC 681
            :|           .:.|||    |.:....:.|..|:|
Human   647 LPEEICNAEEDDDSNLEHLHLENNYIKIREIPSYTFSC 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 LRRNT 73..103 CDD:214470
leucine-rich repeat 83..104 CDD:275380
LRR_8 102..160 CDD:290566
leucine-rich repeat 105..125 CDD:275380
LRR_RI <119..259 CDD:238064
leucine-rich repeat 126..149 CDD:275380
LRR_8 149..208 CDD:290566
leucine-rich repeat 150..173 CDD:275380
leucine-rich repeat 174..197 CDD:275380
LRR_8 197..256 CDD:290566
leucine-rich repeat 198..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
leucine-rich repeat 246..371 CDD:275380 18/82 (22%)
LRRCT 254..303 CDD:214507 3/8 (38%)
LRRNT 319..350 CDD:214470 6/30 (20%)
LRR_8 349..406 CDD:290566 24/58 (41%)
LRR_4 371..411 CDD:289563 17/41 (41%)
leucine-rich repeat 372..395 CDD:275380 12/24 (50%)
leucine-rich repeat 396..415 CDD:275380 6/18 (33%)
leucine-rich repeat 420..443 CDD:275380 7/22 (32%)
leucine-rich repeat 444..465 CDD:275380 9/23 (39%)
leucine-rich repeat 468..480 CDD:275378 4/12 (33%)
LRRCT 476..525 CDD:214507 16/53 (30%)
leucine-rich repeat 484..545 CDD:275380 16/65 (25%)
LRRNT 542..574 CDD:214470 7/33 (21%)
leucine-rich repeat 552..570 CDD:275380 3/17 (18%)
leucine-rich repeat 572..596 CDD:275380 7/24 (29%)
LRR_RI <574..>678 CDD:238064 36/125 (29%)
LRR_8 595..655 CDD:290566 22/65 (34%)
leucine-rich repeat 597..620 CDD:275380 9/24 (38%)
leucine-rich repeat 621..644 CDD:275380 7/22 (32%)
leucine-rich repeat 645..668 CDD:275380 9/40 (23%)
leucine-rich repeat 669..756 CDD:275380 3/13 (23%)
LRRCT 677..726 CDD:214507 2/5 (40%)
LRRNT 739..770 CDD:214470
leucine-rich repeat 757..791 CDD:275380
LRR_4 770..807 CDD:289563
LRR_8 790..850 CDD:290566
LRR_4 791..830 CDD:289563
leucine-rich repeat 792..815 CDD:275380
LRR_4 814..863 CDD:289563
leucine-rich repeat 816..839 CDD:275380
leucine-rich repeat 840..861 CDD:275380
LRRCT 872..920 CDD:214507
EGF 935..966 CDD:278437
EGF_CA 971..1007 CDD:238011
EGF_CA 1009..1045 CDD:238011
EGF_CA 1055..1086 CDD:238011
EGF_CA 1088..1124 CDD:238011
Laminin_G_1 1204..1335 CDD:278483
CT 1435..1504 CDD:214482
ECM2NP_001384.1 VWC 103..157 CDD:278520
Amnionless <116..>213 CDD:317263
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..316 5/30 (17%)
Cell attachment site. /evidence=ECO:0000255 294..296 0/1 (0%)
NEL <320..>572 CDD:330839 80/274 (29%)
leucine-rich repeat 321..344 CDD:275380 4/22 (18%)
leucine-rich repeat 345..368 CDD:275380 7/22 (32%)
LRR 1 368..388 10/19 (53%)
leucine-rich repeat 369..394 CDD:275380 12/24 (50%)
LRR 2 394..415 6/23 (26%)
leucine-rich repeat 395..415 CDD:275380 6/22 (27%)
leucine-rich repeat 416..439 CDD:275380 7/22 (32%)
LRR 3 416..436 5/19 (26%)
LRR 4 439..459 8/20 (40%)
leucine-rich repeat 440..465 CDD:275380 9/25 (36%)
LRR 5 465..484 6/18 (33%)
leucine-rich repeat 466..486 CDD:275380 6/19 (32%)
LRR 6 486..507 6/24 (25%)
leucine-rich repeat 487..510 CDD:275380 7/26 (27%)
LRR 491..>673 CDD:227223 56/205 (27%)
LRR 7 510..530 7/34 (21%)
leucine-rich repeat 511..536 CDD:275380 8/39 (21%)
LRR 8 536..557 4/20 (20%)
LRR 9 558..578 6/20 (30%)
LRR 10 582..602 6/19 (32%)
leucine-rich repeat 583..606 CDD:275380 7/22 (32%)
LRR 11 609..630 7/24 (29%)
leucine-rich repeat 610..632 CDD:275380 7/25 (28%)
LRR 12 632..653 5/20 (25%)
leucine-rich repeat 633..653 CDD:275380 5/19 (26%)
LRR 13 661..684 6/22 (27%)
leucine-rich repeat 662..687 CDD:275380 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.