DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sli and LRRC38

DIOPT Version :9

Sequence 1:NP_001261017.1 Gene:sli / 36746 FlyBaseID:FBgn0264089 Length:2157 Species:Drosophila melanogaster
Sequence 2:NP_001010847.1 Gene:LRRC38 / 126755 HGNCID:27005 Length:294 Species:Homo sapiens


Alignment Length:238 Identity:81/238 - (34%)
Similarity:118/238 - (49%) Gaps:14/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 CSGLTEHAPMECGAENSCPHPCRCAD-GIVDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKS 365
            ||.|...||     .::||..|.|.| ..||||::.|.|||...|.|..:|.:..|.|..:|...
Human    16 CSLLLLLAP-----GHACPAGCACTDPHTVDCRDRGLPSVPDPFPLDVRKLLVAGNRIQRIPEDF 75

  Fly   366 FSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEI 430
            |..:..|..:|..||::..:.....||..:|..|.|..|.:..|.:|.|:..|.|..|.|..|.:
Human    76 FIFYGDLVYLDFRNNSLRSLEEGTFSGSAKLVFLDLSYNNLTQLGAGAFRSAGRLVKLSLANNNL 140

  Fly   431 SCIRKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCN----LRWLADYL 491
            ..:.:|||..|.||.:|.|.|||::||:.....|:.:::::.|..||::|||:    ..|:.:..
Human   141 VGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENA 205

  Fly   492 HKNPIETSGARCESPKRMHRRRIESLREEKFKCSWDELRMKLS 534
            .|.|......:|..|  |..||| ||||.. :.|:.|.|..||
Human   206 SKLPKGLDEIQCSLP--MESRRI-SLRELS-EASFSECRFSLS 244

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
sliNP_001261017.1 LRRNT 73..103 CDD:214470
leucine-rich repeat 83..104 CDD:275380
LRR_8 102..160 CDD:290566
leucine-rich repeat 105..125 CDD:275380
LRR_RI <119..259 CDD:238064
leucine-rich repeat 126..149 CDD:275380
LRR_8 149..208 CDD:290566
leucine-rich repeat 150..173 CDD:275380
leucine-rich repeat 174..197 CDD:275380
LRR_8 197..256 CDD:290566
leucine-rich repeat 198..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
leucine-rich repeat 246..371 CDD:275380 25/69 (36%)