DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sli and lrrc3b

DIOPT Version :9

Sequence 1:	NP_001261017.1	Gene:	sli / 36746	FlyBaseID:	FBgn0264089	Length:	2157	Species:	Drosophila melanogaster
Sequence 2:	NP_001082985.1	Gene:	lrrc3b / 100037364	ZFINID:	ZDB-GENE-070410-55	Length:	258	Species:	Danio rerio

Alignment Length:	151	Identity:	50/151 - (33%)
Similarity:	71/151 - (47%)	Gaps:	34/151 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   739 CPPSCTCT-------GTVVRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRH-LRSLTRL 795
            ||..|||.       |..|.||.::|||||..:|.:|..|.|:.|.|..:. :||.| ||.|.||
Zfish    34 CPKGCTCQRSESPPHGLNVTCSLSRLKEIPPDVPPDTQLLQLDRNHISLVP-DRIFHGLRMLRRL 97

  Fly   796 DLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFED 860
            :||:|.:..|....|..|.                       .:|.||.|..|||:.:.:.:|..
Zfish    98 NLSHNAVETLGEGAFIGLE-----------------------GSLEVLDLSYNRITSVHKDAFAR 139

  Fly   861 LKSLTHIALGSNPLYCDCGLK 881
            ||:  .:.:.:||.:|||.|:
Zfish   140 LKA--RVVVDNNPWHCDCALQ 158

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sli	NP_001261017.1	LRRNT	73..103	CDD:214470
		leucine-rich repeat	83..104	CDD:275380
		LRR_8	102..160	CDD:290566
		leucine-rich repeat	105..125	CDD:275380
		LRR_RI	<119..259	CDD:238064
		leucine-rich repeat	126..149	CDD:275380
		LRR_8	149..208	CDD:290566
		leucine-rich repeat	150..173	CDD:275380
		leucine-rich repeat	174..197	CDD:275380
		LRR_8	197..256	CDD:290566
		leucine-rich repeat	198..221	CDD:275380
		leucine-rich repeat	222..245	CDD:275380
		leucine-rich repeat	246..371	CDD:275380
		LRRCT	254..303	CDD:214507
		LRRNT	319..350	CDD:214470
		LRR_8	349..406	CDD:290566
		LRR_4	371..411	CDD:289563
		leucine-rich repeat	372..395	CDD:275380
		leucine-rich repeat	396..415	CDD:275380
		leucine-rich repeat	420..443	CDD:275380
		leucine-rich repeat	444..465	CDD:275380
		leucine-rich repeat	468..480	CDD:275378
		LRRCT	476..525	CDD:214507
		leucine-rich repeat	484..545	CDD:275380
		LRRNT	542..574	CDD:214470
		leucine-rich repeat	552..570	CDD:275380
		leucine-rich repeat	572..596	CDD:275380
		LRR_RI	<574..>678	CDD:238064
		LRR_8	595..655	CDD:290566
		leucine-rich repeat	597..620	CDD:275380
		leucine-rich repeat	621..644	CDD:275380
		leucine-rich repeat	645..668	CDD:275380
		leucine-rich repeat	669..756	CDD:275380	9/23 (39%)
		LRRCT	677..726	CDD:214507
		LRRNT	739..770	CDD:214470	16/37 (43%)
		leucine-rich repeat	757..791	CDD:275380	15/34 (44%)
		LRR_4	770..807	CDD:289563	16/37 (43%)
		LRR_8	790..850	CDD:290566	15/59 (25%)
		LRR_4	791..830	CDD:289563	9/38 (24%)
		leucine-rich repeat	792..815	CDD:275380	9/22 (41%)
		LRR_4	814..863	CDD:289563	9/48 (19%)
		leucine-rich repeat	816..839	CDD:275380	0/22 (0%)
		leucine-rich repeat	840..861	CDD:275380	8/20 (40%)
		LRRCT	872..920	CDD:214507	6/10 (60%)
		EGF	935..966	CDD:278437
		EGF_CA	971..1007	CDD:238011
		EGF_CA	1009..1045	CDD:238011
		EGF_CA	1055..1086	CDD:238011
		EGF_CA	1088..1124	CDD:238011
		Laminin_G_1	1204..1335	CDD:278483
		CT	1435..1504	CDD:214482
lrrc3b	NP_001082985.1	LRRNT	34..72	CDD:214470	16/37 (43%)
		LRR 1	69..90		7/21 (33%)
		leucine-rich repeat	70..93	CDD:275378	9/23 (39%)
		LRR_8	73..129	CDD:290566	23/79 (29%)
		LRR 2	93..114		8/20 (40%)
		LRR_4	94..132	CDD:289563	16/60 (27%)
		leucine-rich repeat	94..118	CDD:275378	9/46 (20%)
		LRR 3	118..139		8/20 (40%)
		leucine-rich repeat	119..142	CDD:275378	9/22 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4237
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810