DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tun and AT2G41760

DIOPT Version :9

Sequence 1:NP_001246351.1 Gene:tun / 36743 FlyBaseID:FBgn0034046 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_565959.1 Gene:AT2G41760 / 818775 AraportID:AT2G41760 Length:221 Species:Arabidopsis thaliana


Alignment Length:178 Identity:78/178 - (43%)
Similarity:103/178 - (57%) Gaps:18/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YCEENVWKLCEQVKRTRPEE--LSKCYAVFVSNEGRTVPLWRQKAGRGDDQVVIWDYHVFFIH-- 79
            ||||||:.||:.:......|  .|..:.||:|||.:.||||.|||....|.||:|||||..:.  
plant    22 YCEENVYLLCKTLCENGVAEATCSDLFVVFISNEKKQVPLWHQKASTRADGVVLWDYHVICVQRK 86

  Fly    80 -----NPLLNRCLVFDLDTTLPFPTYFHKYVTETFRSDLALRPEHHRFFRVIPADTYLIEFSSDR 139
                 .|     ||:|||:|||||:....|||||.:....|..|:.||||::.|..:...|:|||
plant    87 KESDSEP-----LVWDLDSTLPFPSPLASYVTETIQPSFQLFAEYQRFFRIVHAPLFFKHFASDR 146

  Fly   140 RHMRRPDGSWIKPPPSYPPILSNSN-MHCLGDFICMSAGKGPGSVYSL 186
            |||:.|||||...||.|.||::... :|.|.::|.||   |..::.||
plant   147 RHMKEPDGSWTAQPPPYEPIVAQDGILHNLSEYIAMS---GADTLSSL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tunNP_001246351.1 Nt_Gln_amidase 15..185 CDD:286805 76/175 (43%)
AT2G41760NP_565959.1 Nt_Gln_amidase 18..186 CDD:286805 76/171 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 144 1.000 Domainoid score I1490
eggNOG 1 0.900 - - E1_KOG3261
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9968
Inparanoid 1 1.050 144 1.000 Inparanoid score I1767
OMA 1 1.010 - - QHG57858
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006515
OrthoInspector 1 1.000 - - oto3014
orthoMCL 1 0.900 - - OOG6_105008
Panther 1 1.100 - - LDO PTHR13035
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4749
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.