DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tun and Ntaq1

DIOPT Version :9

Sequence 1:NP_001246351.1 Gene:tun / 36743 FlyBaseID:FBgn0034046 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_038935446.1 Gene:Ntaq1 / 362914 RGDID:1311362 Length:242 Species:Rattus norvegicus


Alignment Length:221 Identity:89/221 - (40%)
Similarity:118/221 - (53%) Gaps:36/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKISDCSYVSCYCEENVWKLCEQVKRTRPEELSKCYAVFVSNEGR-------------------- 52
            |....|.|.|||||||:|||||.:|......|.:|||||:|||.:                    
  Rat    18 PTRDACVYSSCYCEENIWKLCEYIKTHNQYLLEECYAVFISNEKKMNPEEGVGFLGTRATDVCKL 82

  Fly    53 ---------------TVPLWRQKAGRGDDQVVIWDYHVFFIHNPLLNRCLVFDLDTTLPFPTYFH 102
                           .||:|:|:| |.::..|||||||..:|.....:..::||||.||||..|.
  Rat    83 PCGCWEQILGPLQEQQVPIWKQQA-RPENGPVIWDYHVVLLHVSREGQSFIYDLDTILPFPCPFD 146

  Fly   103 KYVTETFRSDLALRPEHHRFFRVIPADTYLIEFSSDRRHMRRPDGSWIKPPPSYPPILSNSNMHC 167
            .|:.:..:||..:.|:..|.|||:.||:||..|:|||.||:...|:|.:|||.||.|.:..:...
  Rat   147 IYIEDALKSDDDIHPQFRRKFRVVRADSYLKNFASDRSHMKDSSGNWREPPPEYPCIETGDSKMN 211

  Fly   168 LGDFICMSAGKGPGSVYSLSEFVQNF 193
            |.|||.|....|.|:||:|||||..|
  Rat   212 LNDFISMDPAVGWGAVYTLSEFVHRF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tunNP_001246351.1 Nt_Gln_amidase 15..185 CDD:286805 80/204 (39%)
Ntaq1XP_038935446.1 Nt_Gln_amidase 25..229 CDD:401639 80/204 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353312
Domainoid 1 1.000 185 1.000 Domainoid score I3305
eggNOG 1 0.900 - - E1_KOG3261
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9968
Inparanoid 1 1.050 188 1.000 Inparanoid score I3817
OMA 1 1.010 - - QHG57858
OrthoDB 1 1.010 - - D1337506at2759
OrthoFinder 1 1.000 - - FOG0006515
OrthoInspector 1 1.000 - - oto98228
orthoMCL 1 0.900 - - OOG6_105008
Panther 1 1.100 - - LDO PTHR13035
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4749
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.